CRF (human, rat)

Catalog # Availability Size / Price Qty
1151/200U
CRF (human, rat)
1 Image
Description: Stimulates ACTH release
Alternative Names: Corticotropin-Releasing Factor (human, rat)

Purity: ≥95%

Product Details
Citations (10)
Reviews

Biological Activity

CRF (human, rat) is a endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.

Technical Data

M.Wt:
4758
Formula:
C208H344N60O63S2
Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

(Modifications: Ile-41 = C-terminal amide)

Solubility:
Soluble to 1.10 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
86784-80-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Additional Information

Licensing Caveats:
Sold with the permission of the SALK Institute

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for CRF (human, rat)

The citations listed below are publications that use Tocris products. Selected citations for CRF (human, rat) include:

10 Citations: Showing 1 - 10

  1. Exchange protein directly activated by cAMP 2 is required for CRH-releasing hormone-mediated spine loss.
    Authors: Xie Et al.
    Eur J Neurosci  2019;
  2. Deciphering the Contributions of CRH Receptors in the Brain and Pituitary to Stress-Induced Inhibition of the Reproductive Axis.
    Authors: Raftogianni Et al.
    Front Mol Neurosci  2018;11:305
  3. CRF-R1 activation in the anterior-dorsal BNST induces maternal neglect in lactating rats via an HPA axis-independent central mechanism.
    Authors: Klampfl Et al.
    J Neuroinflammation  2016;64:89
  4. Systemic pro-inflammatory response facilitates the development of cerebral edema during short hypoxia.
    Authors: Song Et al.
    J Neurosci  2016;13:63
  5. Orexin-corticotropin-releasing factor receptor heteromers in the ventral tegmental area as targets for cocaine.
    Authors: Navarro Et al.
    Psychoneuroendocrinology  2015;35:6639
  6. Corticotropin-releasing hormone drives anandamide hydrolysis in the amygdala to promote anxiety.
    Authors: Gray Et al.
    J Neurosci  2015;35:3879
  7. Corticotropin releasing factor and catecholamines enhance glutamatergic neurotransmission in the lateral subdivision of the central amygdala.
    Authors: Silberman and Winder
    Neuropharmacology  2013;70:316
  8. Corticotropin releasing factor signaling in the central amygdala is recruited during binge-like ethanol consumption in C57BL/6J mice.
    Authors: Lowery-Gionta Et al.
    J Neurosci  2012;32:3405
  9. The dysphoric component of stress is encoded by activation of the dynorphin kappa-opioid system.
    Authors: Land Et al.
    J Neurosci  2008;28:407
  10. Corticotropin-releasing factor (CRF) and the urocortins differentially regulate catecholamine secretion in human and rat adrenals, in a CRF receptor type-specific manner.
    Authors: Dermitzaki Et al.
    Endocrinology  2007;148:1524

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for CRF (human, rat)

There are currently no reviews for this product. Be the first to review CRF (human, rat) and earn rewards!

Have you used CRF (human, rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.