Home / Ubiquitin / Human Ubiquitin Antibody

Human Ubiquitin Antibody

Catalog #: A-104
3 Citations Datasheet / COA / SDS
Product is in the process of being discontinued

Discontinued Product

A-104 has been discontinued.
View all Ubiquitin products.
Detection of Human Ubiquitin by Western Blot.
1 Image
Product Details
Citations (3)
FAQs
Reviews
Summary Data Examples Preparation and Storage Reconstitution Calculator Background Product Datasheets Related Research Areas

Human Ubiquitin Antibody Summary

Species Reactivity
Human
Specificity
This antibody detects human Ubiquitin and Ubiquitin+1 in Western blots.
Source
Monoclonal Mouse IgG2B Clone # 83406
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Ubiquitin+1 synthetic peptide
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
Formulation
Supplied as a solution in PBS containing Glycerol and Sodium Azide.
Label
Unconjugated

Applications

Recommended Concentration
Sample
Western Blot
0.1-0.5 µg/mL
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Western Blot Detection of Human Ubiquitin antibody by Western Blot. View Larger

Detection of Human Ubiquitin by Western Blot. Western blot shows lysates of HCT-116 human colorectal carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Ubiquitin Monoclonal Antibody (Catalog # A-104) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for Ubiquitin at approximately 5-10 & 37-250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store the unopened product at -20 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Storage below -20 °C is not recommended. Do not use past expiration date.

Background: Ubiquitin

Ubiquitin is a 76 amino acid (aa) protein that is ubiquitously expressed in all eukaryotic organisms. Ubiquitin is highly conserved with 96% aa sequence identity shared between human and yeast. In mammals, four ubiquitin genes encode for two ubiquitin­ribosomal fusion proteins and two polyubiquitin proteins. Cleavage of the ubiquitin precursors by deubiquitinating enzymes gives rise to identical ubiquitin monomers each with a predicted molecular weight of 8.6 kDa. Conjugation of ubiquitin to target proteins involves the formation of an isopeptide bond between the C­terminal glycine residue of ubiquitin and a lysine residue in the target protein. This process of conjugation, referred to as ubiquitination or ubiquitylation, is a multi­step process that requires three enzymes: a ubiquitin­activating (E1) enzyme, a ubiquitin­conjugating (E2) enzyme, and a ubiquitin ligase (E3). Ubiquitination is classically recognized as a mechanism to target proteins for degradation and as a result, ubiquitin was originally named ATP­dependent Proteolysis Factor 1 (APF­1). In addition to protein degradation, ubiquitination has been shown to mediate a variety of biological processes such as signal transduction, endocytosis, and post­endocytic sorting.

References

Entrez Gene IDs
7314 (Human); 298693 (Rat)
Alternate Names
RPS27A; UBA52; UBB ubiquitin B; UBB; UBC; Ubiquitin

Product Datasheets

You must select a language.

x
Product Datasheet
COA
SDS

Product Specific Notices

* Contains <0.1% Sodium Azide, which is not hazardous at this concentration according to GHS classifications. Refer to SDS for additional information and handling instructions.

Citations for Human Ubiquitin Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

3 Citations: Showing 1 - 3
Filter your results:

Filter by:

  1. Beneficial Effects of Resveratrol in Mouse Gastrocnemius: A Hint to Muscle Phenotype and Proteolysis
    Authors: L Mañas-Garc, C Denhard, J Mateu, X Duran, J Gea, E Barreiro
    Cells, 2021-09-15;10(9):.
    Species: Mouse
    Sample Types: Tissue Homogenates
    Applications: Western Blot
  2. Site-specific ubiquitylation and SUMOylation using genetic-code expansion and sortase
    Authors: M Fottner, AD Brunner, V Bittl, D Horn-Ghetk, A Jussupow, VRI Kaila, A Bremm, K Lang
    Nat. Chem. Biol., 2019-02-15;15(3):276-284.
    Species: Human
    Sample Types: Recombinant Protein
    Applications: Western Blot
  3. Trichostatin A, a histone deacetylase inhibitor suppresses NADPH Oxidase 4-Derived Redox Signalling and Angiogenesis
    Authors: Nora Y Hakami
    J Cell Mol Med, 2016-06-14;0(0):.
    Species: Human
    Sample Types: Cell Lysates
    Applications: Immunoprecipitation

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs

Reviews for Human Ubiquitin Antibody

There are currently no reviews for this product. Be the first to review Human Ubiquitin Antibody and earn rewards!

Have you used Human Ubiquitin Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review