Home / Insulin and Insulin-like Receptor Activators / Insulin (human) recombinant, expressed in yeast

Insulin (human) recombinant, expressed in yeast

Catalog #: 3435
7 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
3435/10
Insulin (human) recombinant, expressed in yeast
1 Image
Description: Endogenous peptide agonist
Product Details
Citations (7)
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Insulin (human, recombinant, expressed in yeast) is an endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M.Wt:
5807.57
Formula:
C257H383N65O77S6
Sequence:
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

(Modifications: Disulfide bridges: 6-11, 7-7*, 20-19*)

Solubility:
Soluble to 10 mg/ml in aq. HCl (pH 2.0 - 2.5)
Storage:
Store at -20°C
CAS No:
11061-68-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Age dependent changes of Ins receptors in rat tissues.
    Torlinska et al.
    J.Physiol.Pharmacol., 2000;51:871
  2. The binding characteristics of Ins-MTX to Ins receptor.
    Ou et al.
    Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao., 2001;32:538
  3. The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets.
    Leney and Tavare
    J.Endocrinol., 2009;203:1

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for Insulin (human) recombinant, expressed in yeast

The citations listed below are publications that use Tocris products. Selected citations for Insulin (human) recombinant, expressed in yeast include:

7 Citations: Showing 1 - 7

  1. Microglia-containing cerebral organoids derived from induced pluripotent stem cells for the study of neurological diseases.
    Authors: Yiling Et al.
    iScience  2023;26:106267
  2. Altered temporal sequence of transcriptional regulators in the generation of human cerebellar granule cells.
    Authors: Thomas S Et al.
    Elife  2021;10
  3. Murine- and Human-Derived Autologous Organoid/Immune Cell Co-Cultures as Pre-Clinical Models of Pancreatic Ductal Adenocarcinoma.
    Authors: Yana Et al.
    Cancers (Basel)  2020;12
  4. ins. regulates POMC neuronal plasticity to control glucose metabolism.
    Authors: Dodd Et al.
    Elife  2018;7
  5. A Hypothalamic Phosphatase Switch Coordinates Energy Expenditure with Feeding.
    Authors: Jens C Et al.
    Cell Metab  2017;26:375-393.e7
  6. Hierarchical glucocorticoid-endocannabinoid interplay regulates the activation of the nucleus accumbens by insulin.
    Authors: Pinheiro Et al.
    Brain.Res.Bull.  2016;124:222
  7. GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling.
    Authors: Stretton Et al.
    Br J Pharmacol  2015;470:207

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Insulin (human) recombinant, expressed in yeast

There are currently no reviews for this product. Be the first to review Insulin (human) recombinant, expressed in yeast and earn rewards!

Have you used Insulin (human) recombinant, expressed in yeast?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.