ACTH (1-39)

Catalog #: 3492
4 Citations Datasheet / COA / SDS

Catalog #	Availability	Size / Price	Qty
3492/1

1 Image

Description: Potent endogenous MC2 agonist

Alternative Names: Adrenocorticotropic hormone (1-39)

Purity: ≥95%

View All Products for Melanocortin Receptor Agonists

Product Details

Citations (4)

Supplemental Products

Reviews

Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

ACTH (1-39) is a potent endogenous melanocortin receptor 2 (MC₂) agonist (EC₅₀ = 57 pM). Component of the hypothalamic-pituitary-adrenal (HPA) axis that stimulates glucocorticoid production and release from the adrenal cortex. Induces insulin resistance, promotes a proinflammatory profile and stimulates UCP-1 in adipocytes in vitro.

Technical Data

M.Wt:

4541.1

Formula:

C₂₀₇H₃₀₈N₅₆O₅₈S

Sequence:

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Solubility:

Soluble to 1 mg/ml in water

Purity:

≥95%

Storage:

Store at -20°C

CAS No:

12279-41-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line.
Kapas et al.
Endocrinology, 1996;137:3291
Melanocortin crosstalk with adipose functions: ACTH directly induces Ins resistance, promotes a pro-inflammatory adipokine profile and stimulates UCP-1 in adipocytes.
Iwen et al.
J.Endocrinol., 2008;196:465
Brain effects of melanocortins.
Bertolini et al.
Pharmacol.Res., 2009;59:13

Product Datasheets

COA view current batch

Or select another batch:

View Batch

SDS

Reconstitution Calculator

Molarity Calculator

Reconstitution Calculator

Molarity Calculator

Mass

Concentration

Volume

M. Wt* g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for ACTH (1-39)

The citations listed below are publications that use Tocris products. Selected citations for ACTH (1-39) include:

4 Citations: Showing 1 - 4

Novel bifunctional hybrid compounds designed to enhance the effects of opioids and antagonize the pronociceptive effects of nonopioid peptides as potent analgesics in a rat model of neuropathic pain.
Authors: Ewa Et al.
Pain 2021;162:432-445
Re-evaluation of Adrenocorticotropic Hormone and Melanocyte Stimulating Hormone Activation of GPR139 in Vitro.
Authors: Nepomuceno Et al.
Front Pharmacol 2018;9:157
The orphan G protein-coupled receptor GPR139 is activated by the peptides: Adrenocorticotropic hormone (ACTH), α-, and β-melanocyte stimulating hormone (α-MSH, and β-MSH), and the conserved core motif HFRW.
Authors: Nøhr Et al.
Neurochem Int 2017;102:105
The atherogenic Scarb1 null mouse model shows a high bone mass phenotype.
Authors: Martineau Et al.
Am J Physiol Endocrinol Metab 2014;306:E48

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ACTH (1-39)

There are currently no reviews for this product. Be the first to review ACTH (1-39) and earn rewards!

Have you used ACTH (1-39)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.