Amyloid β-peptide (1-42) (rat)

Catalog # Availability Size / Price Qty
2425/500U
Amyloid β-peptide (1-42) (rat)
1 Image
Description: Predominant amyloid β-protein fragment

Purity: ≥95%

Product Details
Citations (1)
Reviews

Biological Activity

Amyloid β-peptide (1-42) (rat) is a rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer's disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. Neurotoxic.

Technical Data

M.Wt:
4417.99
Formula:
C199H307N53O59S
Sequence:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Solubility:
Soluble to 1 mg/ml in 0.1% Ammonia
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
166090-74-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Amyloid β-protein induces the cerebrovascular cellular pathology of Alzheimer's disease and related disorders.
    Van Nostrand et al.
    Ann.N.Y.Acad.Sci., 1996;777:297
  2. Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein.
    Glenner and Wong
    Biochem.Biophys.Res.Comm., 1984;120:885
  3. Alzheimer's amyloid β-peptide (1-42) induces cell death in human neuroblastoma via bax/bcl-2 ratio increase: An intriguing role for methionine 35.
    Clementi et al.
    Biochem.Biophys.Res.Comm., 2006;342:206

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for Amyloid β-peptide (1-42) (rat)

The citations listed below are publications that use Tocris products. Selected citations for Amyloid β-peptide (1-42) (rat) include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Amyloid β-peptide (1-42) (rat)

There are currently no reviews for this product. Be the first to review Amyloid β-peptide (1-42) (rat) and earn rewards!

Have you used Amyloid β-peptide (1-42) (rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.