Home / Osteocalcin / Human/Rat Osteocalcin Antibody

Human/Rat Osteocalcin Antibody

Catalog #: MAB1419
40 Citations 1 Review Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
MAB1419
MAB1419-SP
Osteocalcin in MG‑63 Human Cell Line.
7 Images
Product Details
Citations (40)
FAQs
Supplemental Products
Reviews (1)
Summary Data Examples Preparation and Storage Reconstitution Calculator Background Product Datasheets Related Research Areas

Human/Rat Osteocalcin Antibody Summary

Species Reactivity
Human, Rat
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
Monoclonal Mouse IgG1 Clone # 190125
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
Purity
Protein A or G purified from hybridoma culture supernatant

Applications

Recommended Concentration
Sample
Immunohistochemistry
8-25 µg/mL
See below
CyTOF-ready
Ready to be labeled using established conjugation methods. No BSA or other carrier proteins that could interfere with conjugation.
 
Immunocytochemistry
8-25 µg/mL
See below
Intracellular Staining by Flow Cytometry
2.5 µg/106 cells
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Immunocytochemistry Osteocalcin antibody in MG-63 Human Cell Line by Immunocytochemistry (ICC). View Larger

Osteocalcin in MG‑63 Human Cell Line. Osteocalcin was detected in immersion fixed MG-63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry Osteocalcin antibody in Human Osteocytes by Immunocytochemistry (ICC). View Larger

Osteocalcin in Human Osteocytes. Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry Osteocalcin antibody in Rat Osteocytes by Immunocytochemistry (ICC). View Larger

Osteocalcin in Rat Osteocytes. Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunohistochemistry Osteocalcin antibody in Human Cartilage by Immunohistochemistry (IHC-P). View Larger

Osteocalcin in Human Cartilage. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Immunohistochemistry Osteocalcin antibody in Human Osteosarcoma by Immunohistochemistry (IHC-P). View Larger

Osteocalcin in Human Osteosarcoma. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin antibody in Saos-2 Human Cell Line antibody by Flow Cytometry. View Larger

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin antibody in Human Osteoblasts antibody by Flow Cytometry. View Larger

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Reconstitution
Reconstitute at 0.5 mg/mL in sterile PBS.
Loading...
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C
Stability & Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
    12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Long Name
Bone gamma-Carboxyglutamate [gla] Protein
Entrez Gene IDs
632 (Human); 12096 (Mouse); 25295 (Rat)
Alternate Names
BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin

Product Datasheets

You must select a language.

x
Product Datasheet
COA
SDS

Citations for Human/Rat Osteocalcin Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

40 Citations: Showing 1 - 10
Filter your results:

Filter by:

  1. Efficacy of sintered Zinc-doped fluorapatite scaffold as an antimicrobial regenerative bone filler for dental applications
    Authors: Steyl, SK;Jeyapalina, S;Griffin, A;Krishnamoorthi, V;Beck, JP;Agarwal, J;Shea, J;
    Journal of dentistry
    Species: Human
    Sample Types: Whole Cells
    Applications: Immunocytochemistry
  2. Direct coupled electrical stimulation towards improved osteogenic differentiation of human mesenchymal stem/stromal cells: a comparative study of different protocols
    Authors: Silva, JC;Meneses, J;Garrudo, FFF;Fernandes, SR;Alves, N;Ferreira, FC;Pascoal-Faria, P;
    Scientific reports
    Species: Human hepegivirus
    Sample Types: Whole Cells
    Applications: Immunocytochemistry
  3. Mechanical and Functional Improvement of ?-TCP Scaffolds for Use in Bone Tissue Engineering
    Authors: Umrath, F;Schmitt, LF;Kliesch, SM;Schille, C;Geis-Gerstorfer, J;Gurewitsch, E;Bahrini, K;Peters, F;Reinert, S;Alexander, D;
    Journal of functional biomaterials
    Species: Human
    Sample Types: Whole Cells
  4. Role of cartilage and bone matrix regulation in early equine osteochondrosis
    Authors: SK Grissom, SA Semevolos, K Duesterdie
    Bone Reports, 2023-01-05;18(0):101653.
    Species: Equine
    Sample Types: Whole Tissue
    Applications: IHC
  5. CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling
    Authors: NT Chan, MS Lee, Y Wang, J Galipeau, WJ Li, W Xu
    Science Advances, 2022-11-16;8(46):eadc9222.
    Species: Human
    Sample Types: Transduced Whole Cells
    Applications: ICC
  6. Trabecular Titanium for Orthopedic Applications: Balancing Antimicrobial with Osteoconductive Properties by Varying Silver Contents
    Authors: Diez-Escudero A, Carlsson E, Andersson B et al.
    ACS Applied Materials & Interfaces
  7. Msx1+ stem cells recruited by bioactive tissue engineering graft for bone regeneration
    Authors: X Zhang, W Jiang, C Xie, X Wu, Q Ren, F Wang, X Shen, Y Hong, H Wu, Y Liao, Y Zhang, R Liang, W Sun, Y Gu, T Zhang, Y Chen, W Wei, S Zhang, W Zou, H Ouyang
    Nature Communications, 2022-09-05;13(1):5211.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  8. Circulating Osteogenic Progenitor Cells Enhanced with Teriparatide or Denosumab Treatment
    Authors: M Giner, MA Vázquez-Gá, MJ Miranda, J Bocio-Nuñe, FJ Olmo-Monte, MA Rico, MA Colmenero, MJ Montoya-Ga
    Journal of Clinical Medicine, 2022-08-14;11(16):.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  9. Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals
    Authors: JP Ribeiro, RMA Domingues, PS Babo, LP Nogueira, JE Reseland, RL Reis, M Gomez-Flor, ME Gomes
    Carbohydrate polymers, 2022-05-20;292(0):119638.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  10. Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats
    Authors: NA Luchman, R Megat Abdu, SH Zainal Ari, NS Nasruddin, SF Lau, F Yazid
    PeerJ, 2022-05-02;10(0):e13356.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  11. Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways
    Authors: B Zhang, M Xiao, X Cheng, Y Bai, H Chen, Q Yu, L Qiu
    Stem Cells International, 2022-04-28;2022(0):2236250.
    Species: Mouse
    Sample Types: Whole Tissue
    Applications: IHC
  12. BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models
    Authors: S Martin-Igl, L Milian, M Sancho-Tel, R Salvador-C, JJ Martín de, C Carda, M Mata
    Stem Cells International, 2022-03-04;2022(0):4910399.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  13. Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence
    Authors: Q Heydt, C Xintaropou, A Clear, M Austin, I Pislariu, F Miraki-Mou, P Cutillas, K Korfi, M Calaminici, W Cawthorn, K Suchacki, A Nagano, JG Gribben, M Smith, JD Cavenagh, H Oakervee, A Castleton, D Taussig, B Peck, A Wilczynska, L McNaughton, D Bonnet, F Mardakheh, B Patel
    Nature Communications, 2021-09-17;12(1):5507.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC/IF
  14. Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration
    Authors: L E, R Lu, J Sun, H Li, W Xu, H Xing, X Wang, T Cheng, S Zhang, X Ma, R Zhang, H Liu
    Stem Cells International, 2021-08-17;2021(0):4465022.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  15. MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes
    Authors: S Lv, J Xu, L Chen, H Wu, W Feng, Y Zheng, P Li, H Zhang, L Zhang, G Chi, Y Li
    Stem Cell Res Ther, 2020-09-11;11(1):392.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  16. Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration
    Authors: C Liang, Z Liu, M Song, W Li, Z Wu, Z Wang, Q Wang, S Wang, K Yan, L Sun, T Hishida, Y Cai, JCI Belmonte, P Guillen, P Chan, Q Zhou, W Zhang, J Qu, GH Liu
    Cell Res., 2020-07-31;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  17. The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect
    Authors: J Chen, C Tu, X Tang, H Li, J Yan, Y Ma, H Wu, C Liu
    Stem Cell Res Ther, 2019-12-16;10(1):379.
    Species: Rat
    Sample Types: Whole Cells
    Applications: ICC
  18. Osteoblasts are "educated" by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment
    Authors: AD Kolb, AB Shupp, D Mukhopadhy, FC Marini, KM Bussard
    Breast Cancer Res., 2019-02-27;21(1):31.
    Species: Human
    Sample Types: Whole Cells, Whole Tissue
    Applications: ICC, IHC-P
  19. Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems
    Authors: V Miceli, M Pampalone, S Vella, AP Carreca, G Amico, PG Conaldi
    Stem Cells Int, 2019-02-18;2019(0):7486279.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  20. Differential expression patterns of Toll Like Receptors and Interleukin-37 between calcific aortic and mitral valve cusps in humans
    Authors: A Kapelouzou, C Kontogiann, DI Tsilimigra, G Georgiopou, L Kaklamanis, L Tsourelis, DV Cokkinos
    Cytokine, 2019-02-01;116(0):150-160.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  21. Influences of donor and host age on human muscle-derived stem cell-mediated bone regeneration
    Authors: X Gao, A Lu, Y Tang, J Schneppend, AB Liebowitz, AC Scibetta, ER Morris, H Cheng, C Huard, S Amra, B Wang, MA Hall, WR Lowe, J Huard
    Stem Cell Res Ther, 2018-11-21;9(1):316.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC-Fr
  22. Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells
    Authors: Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang
    Stem Cell Res Ther, 2018-03-07;9(1):53.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  23. A biomaterials approach to influence stem cell fate in injectable cell-based therapies
    Authors: MH Amer, FRAJ Rose, KM Shakesheff, LJ White
    Stem Cell Res Ther, 2018-02-21;9(1):39.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  24. Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds
    Authors: C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra
    Stem Cells Int, 2017-07-26;2017(0):2976541.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  25. Identification of multipotent stem cells in human brain tissue following stroke
    Authors: K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi
    Stem Cells Dev, 2017-04-19;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  26. Collagen type XV and the 'osteogenic status'
    Authors: G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva
    J. Cell. Mol. Med, 2017-03-22;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  27. 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells
    Authors: YR Lou, TC Toh, YH Tee, H Yu
    Sci Rep, 2017-02-17;7(0):42816.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  28. Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand
    Sci Rep, 2016-07-22;6(0):30311.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  29. Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering
    Stem Cell Reports, 2016-07-12;7(1):126-37.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  30. Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration
    Authors: N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli
    Sci Rep, 2016-04-14;6(0):24305.
    Species: Mouse
    Sample Types: Whole Cells
    Applications: IHC-Fr
  31. PDL regeneration via cell homing in delayed replantation of avulsed teeth.
    Authors: Zhu W, Zhang Q, Zhang Y, Cen L, Wang J
    J Transl Med, 2015-11-14;13(0):357.
    Species: Canine
    Sample Types: Whole Tissue
    Applications: IHC-P
  32. Gene expression profile analysis of human mesenchymal stem cells from herniated and degenerated intervertebral discs reveals different expression of osteopontin.
    Authors: Marfia G, Navone S, Di Vito C, Tabano S, Giammattei L, Di Cristofori A, Gualtierotti R, Tremolada C, Zavanone M, Caroli M, Torchia F, Miozzo M, Rampini P, Riboni L, Campanella R
    Stem Cells Dev, 2014-10-29;24(3):320-8.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  33. Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo.
    Authors: Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K
    Kidney Int, 2014-10-29;87(3):593-601.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  34. Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis.
    Authors: Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C
    Am J Pathol, 2014-03-13;184(5):1369-83.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  35. Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet.
    Authors: Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C
    Am J Pathol, 2013-12-31;184(3):765-77.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  36. Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling.
    Authors: Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J
    PLoS ONE, 2013-03-22;8(3):e59252.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  37. Dilatational band formation in bone.
    Authors: Poundarik, Atharva, Diab, Tamim, Sroga, Grazyna, Ural, Ani, Boskey, Adele L, Gundberg, Caren M, Vashishth, Deepak
    Proc Natl Acad Sci U S A, 2012-11-05;109(47):19178-83.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  38. Age-related changes in rat bone-marrow mesenchymal stem cell plasticity.
    Authors: Asumda FZ, Chase PB
    BMC Cell Biol., 2011-10-12;12(0):44.
    Species: Rat
    Sample Types: Whole Cells
    Applications: ICC
  39. The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate.
    Authors: Curran JM, Chen R, Hunt JA
    Biomaterials, 2006-06-02;27(27):4783-93.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  40. A hybrid coating of biomimetic apatite and osteocalcin.
    Authors: Krout A, Wen HB, Hippensteel E, Li P
    J Biomed Mater Res A, 2005-06-15;73(4):377-87.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs
Loading...

Reviews for Human/Rat Osteocalcin Antibody

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Human/Rat Osteocalcin Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Human/Rat Osteocalcin Antibody
By Anonymous on 08/17/2021
Application: IHC Sample Tested: Osteosarcoma Species: Human
Immunohistochemistry Human/Rat Osteocalcin Antibody MAB1419