Human Ubiquitin Antibody
Human Ubiquitin Antibody Summary
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
Applications
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Scientific Data
Detection of Human Ubiquitin by Western Blot. Western blot shows lysates of HCT-116 human colorectal carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Ubiquitin Monoclonal Antibody (Catalog # A-104) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for Ubiquitin at approximately 5-10 & 37-250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Reconstitution Calculator
Preparation and Storage
Background: Ubiquitin
Ubiquitin is a 76 amino acid (aa) protein that is ubiquitously expressed in all eukaryotic organisms. Ubiquitin is highly conserved with 96% aa sequence identity shared between human and yeast. In mammals, four ubiquitin genes encode for two ubiquitinribosomal fusion proteins and two polyubiquitin proteins. Cleavage of the ubiquitin precursors by deubiquitinating enzymes gives rise to identical ubiquitin monomers each with a predicted molecular weight of 8.6 kDa. Conjugation of ubiquitin to target proteins involves the formation of an isopeptide bond between the Cterminal glycine residue of ubiquitin and a lysine residue in the target protein. This process of conjugation, referred to as ubiquitination or ubiquitylation, is a multistep process that requires three enzymes: a ubiquitinactivating (E1) enzyme, a ubiquitinconjugating (E2) enzyme, and a ubiquitin ligase (E3). Ubiquitination is classically recognized as a mechanism to target proteins for degradation and as a result, ubiquitin was originally named ATPdependent Proteolysis Factor 1 (APF1). In addition to protein degradation, ubiquitination has been shown to mediate a variety of biological processes such as signal transduction, endocytosis, and postendocytic sorting.
Product Datasheets
Product Specific Notices
* Contains <0.1% Sodium Azide, which is not hazardous at this concentration according to GHS classifications. Refer to SDS for additional information and handling instructions.Citations for Human Ubiquitin Antibody
R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.
4
Citations: Showing 1 - 4
Filter your results:
Filter by:
-
Parkin Precipitates on Mitochondria via Aggregation and Autoubiquitination
Authors: Ardah, MT;Radwan, N;Khan, E;Kitada, T;Haque, ME;
International journal of molecular sciences
Species: N/A
Sample Types: Recombinant Protein
Applications: Bioassay -
Beneficial Effects of Resveratrol in Mouse Gastrocnemius: A Hint to Muscle Phenotype and Proteolysis
Authors: L Mañas-Garc, C Denhard, J Mateu, X Duran, J Gea, E Barreiro
Cells, 2021-09-15;10(9):.
Species: Mouse
Sample Types: Tissue Homogenates
Applications: Western Blot -
Site-specific ubiquitylation and SUMOylation using genetic-code expansion and sortase
Authors: M Fottner, AD Brunner, V Bittl, D Horn-Ghetk, A Jussupow, VRI Kaila, A Bremm, K Lang
Nat. Chem. Biol., 2019-02-15;15(3):276-284.
Species: Human
Sample Types: Recombinant Protein
Applications: Western Blot -
Trichostatin A, a histone deacetylase inhibitor suppresses NADPH Oxidase 4-Derived Redox Signalling and Angiogenesis
Authors: Nora Y Hakami
J Cell Mol Med, 2016-06-14;0(0):.
Species: Human
Sample Types: Cell Lysates
Applications: Immunoprecipitation
FAQs
No product specific FAQs exist for this product, however you may
View all Antibody FAQsReviews for Human Ubiquitin Antibody
There are currently no reviews for this product. Be the first to review Human Ubiquitin Antibody and earn rewards!
Have you used Human Ubiquitin Antibody?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image