Iberiotoxin

Catalog #: 1086
15 Citations Datasheet / COA / SDS

Catalog #	Availability	Size / Price	Qty
1086/100U

1 Image

Description: KCa (BK) channel blocker

Purity: ≥95%

View All Products for Ca2+-Activated Potassium Channel Blockers

Product Details

Citations (15)

Reviews

Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Iberiotoxin is a selective blocker of the big conductance Ca²⁺-activated K⁺ channel.

Technical Data

M.Wt:

4230

Formula:

C₁₇₉H₂₇₄N₅₀O₅₅S₇

Sequence:

XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

(Modifications: X-1 = pGlu, Disulfide bridges: 7-28, 13-33, 17-35)

Solubility:

Soluble to 0.70 mg/ml in water

Purity:

≥95%

Storage:

Store at -20°C

CAS No:

129203-60-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus.
Galvez et al.
J.Biol.Chem., 1990;265:11083
Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues.
Suarez-Kurtz et al.
J.Pharmacol.Exp.Ther., 1991;259:439

Product Datasheets

COA view current batch

Or select another batch:

View Batch

SDS

Reconstitution Calculator

Molarity Calculator

Reconstitution Calculator

Molarity Calculator

Mass

Concentration

Volume

M. Wt* g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for Iberiotoxin

The citations listed below are publications that use Tocris products. Selected citations for Iberiotoxin include:

15 Citations: Showing 1 - 10

BK Channels Localize to the Paranodal Junction and Regulate Action Potentials in Myelinated Axons of Cerebellar Purkinje Cells.
Authors: Hirono Et al.
Am J Physiol Cell Physiol 2015;35:7082
The role of K+ and Cl- channels in the regulation of retinal arteriolar tone and blood flow.
Authors: Needham Et al.
FASEB J 2014;55:2157
Maternal nutrient restriction during pregnancy impairs an endothelium-derived hyperpolarizing factor-like pathway in sheep fetal coronary arteries.
Authors: Shukla Et al.
Am J Physiol Heart Circ Physiol 2014;307:H134
BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo.
Authors: Lai Et al.
Am J Physiol Heart Circ Physiol 2014;307:H1327
Bupivacaine-induced Vasodilation Is Mediated by Decreased Calcium Sensitization in Isolated Endothelium-denuded Rat Aortas Precontracted with Phenylephrine.
Authors: Ok Et al.
Korean J Pain 2014;27:229
Quercetin acutely relaxes airway smooth muscle and potentiates β-agonist-induced relaxation via dual phosphodiesterase inhibition of PLCβ and PDE4.
Authors: Townsend and Emala
Am J Physiol Lung Cell Mol Physiol 2013;305:L396
Mechanisms underlying activation of transient BK current in rabbit urethral smooth muscle cells and its modulation by IP3-generating agonists.
Authors: Kyle Et al.
Invest Ophthalmol Vis Sci 2013;305:C609
Slo1 is the principal potassium channel of human spermatozoa.
Authors: Mannowetz Et al.
Elife (Cambridge) 2013;2:e01009
Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice.
Authors: Wan Et al.
Mol Pain 2013;27:1859
The expression and relaxant effect of bitter taste receptors in human bronchi.
Authors: Grassin-Delyle Et al.
Respir Res 2013;14:134

The bitter taste receptor (TAS2R) agonists denatonium and chloroquine display distinct patterns of relaxation of the guinea pig trachea.
Authors: Pulkkinen Et al.
Am J Physiol Lung Cell Mol Physiol 2012;303:L956

NE causes a biphasic change in mammalian pinealocye membrane potential: role of alpha1B-adrenoreceptors, phospholipase C, and Ca²⁺.
Authors: Zemkova Et al.
Endocrinology 2011;152:3842

Relaxant effect and possible mechanism of 17-nor-subincanadine E in rabbit corpora cavernosa.
Authors: Benvindo Et al.
Asian J Androl 2011;13:747

Role of perivascular adipose tissue-derived methyl palmitate in vascular tone regulation and pathogenesis of hypertension.
Authors: Lee Et al.
Circulation 2011;124:1160

Ionic basis of ON and OFF persistent activity in layer III lateral entorhinal cortical principal neurons.
Authors: Tahvildari Et al.
J Neurophysiol 2008;99:2006

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Iberiotoxin

There are currently no reviews for this product. Be the first to review Iberiotoxin and earn rewards!

Have you used Iberiotoxin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.