Home / Parathyroid Hormone Receptor Agonists / Parathyroid hormone (1-34) (human)

Parathyroid hormone (1-34) (human)

Catalog #: 3011
2 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
3011/1
Parathyroid hormone (1-34) (human)
1 Image
Description: Parathyroid hormone (PTH) receptor agonist
Alternative Names: PTH 1-34, hPTH (1-34), Teriparatide

Purity: ≥95%

Product Details
Citations (2)
Supplemental Products
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Parathyroid hormone (1-34) (human) is a human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.

Technical Data

M.Wt:
4117.75
Formula:
C181H291N55O51S2
Sequence:
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Solubility:
Soluble to 0.40 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
52232-67-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats.
    Dobnig and Turner
    Endocrinology, 1997;138:4607
  2. Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys.
    Manabe et al.
    Bone, 2007;40:1475
  3. The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone.
    Niall et al.
    Proc.Natl.Acad.Sci., 1974;71:384

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

⚠ WARNING: This product can expose you to chemicals including Teriparatide, which is known to the State of California to cause cancer. For more information, go to www.P65Warnings.ca.gov

Citations for Parathyroid hormone (1-34) (human)

The citations listed below are publications that use Tocris products. Selected citations for Parathyroid hormone (1-34) (human) include:

2 Citations: Showing 1 - 2

  1. TGFβ-induced degradation of TRAF3 in mesenchymal progenitor cells causes age-related osteoporosis.
    Authors: Li Et al.
    Nat Commun  2019;10:2795
  2. Generation and use of a humanized bone-marrow-ossicle niche for hematopoietic xenotransplantation into mice.
    Authors: Reinisch Et al.
    Nat Protoc  2017;12:2169

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Parathyroid hormone (1-34) (human)

There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (human) and earn rewards!

Have you used Parathyroid hormone (1-34) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.